Anti-ACTH Polyclonal Antibody

Polyclonal Antibodies
More Information
Product Name Anti-ACTH Polyclonal Antibody
Description Rabbit IgG polyclonal antibody for Pro-opiomelanocortin(POMC) detection. Tested with IHC-P in Human, Mouse, Rat.
Background Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.
Host Rabbit
Isotype Rabbit IgG
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.
Synonyms ACTH antibody, Adrenocorticotropic hormone antibody, Adrenocorticotropin antibody, Adrenocorticotropin Hormone antibody, Alpha Melanocyte Stimulating Hormone antibody, alpha-MSH antibody, alphaMSH antibody, Beta Endorphin antibody, Beta Lipotropin antibody, Beta LPH antibody, Beta Melanocyte Stimulating Hormone antibody, Beta-endorphin antibody, beta-MSH antibody, CLIP antibody, Corticotropin antibody, Corticotropin Like Intermediary Peptide antibody, Corticotropin lipotropin antibody, Corticotropin lipotropin precursor antibody, Corticotropin-like intermediary peptide antibody, Gamma LPH antibody, gamma-MSH antibody, Lipotropin Beta antibody, Lipotropin Gamma antibody, Lipotropin, included antibody, LPH antibody, Melanocyte-stimulating hormone, included antibody, Melanotropin Alpha antibody, Melanotropin beta antibody, Melanotropin gamma antibody, Melanotropin, included antibody, Met Enkephalin antibody, Met-enkephalin antibody, MSH antibody, NPP antibody, Opiomelanocortin prepropeptide antibody, POC antibody, POMC antibody, Pomc-1 antibody, Pomc1 antibody, Pomc2 antibody, Pro ACTH endorphin antibody, Pro opiomelanocortin antibody, Pro-opiomelanocortin-alpha antibody, Proopiomelanocortin antibody, Proopiomelanocortin preproprotein antibody, Tetracosactide antibody
Specificity No cross reactivity with other proteins.
Reactivity Predicted to work with: human, Rat, Reacts with: mouse
Applications IHC
Form Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Entrez ID 5443
Uniprot P01189

All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.

Have questions?

An ARP Customer Service Representative is happy to help!