| Product Name | Anti-alpha B Crystallin Antibody [2E8] |
|---|---|
| Description | Mouse monoclonal [2E8] antibody to alpha B Crystallin. |
| Host | Mouse |
| Clonality | Monoclonal |
| Clone | 2E8 |
| Conjugate | Unconjugated |
| Immunogen | Recombinant human alpha B crystallin (amino acids 1-175) purified from E. coli. |
| Isotype | IgG2b |
| Molecular Weight | Approximately 20 kDa in mouse eye cell lysates. |
| Target | alpha B Crystallin |
| Amino Acid Sequence | MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK |
| Protein Length | 175 |
| Specificity | This antibody recognises the basic (b) form of alpha crystallin, alpha B crystallin, a 20kDa water-soluble major structural protein and member of the heat shock protein family, designated HSPB5, which acts as a molecular chaperone and plays a role in the maintenance of ocular lens transparency/refractive index.Besides the involvement of both alpha A and alpha B crystallin in the prevention of protein precipitation and cataract formation in the eye, alpha crystallins have also been demonstrated in other tissues including the heart, brain, kidney, spleen and thymus. Mutation in alpha B crystallin is responsible for desmin-related myopathy and cataract 16 (Perng et al. 1999.). Alpha B crystallin is also a major component of the astrocytic inclusions known as "Rosenthal fibers" found in Alexander's disease. |
| Reactivity | Human, Mouse |
| Applications | ELISA, WB |
| Working Dilutions | WB: 1:1,000 - 1:2,000 |
| Form | Liquid |
| Diluent Buffer | Supplied in Phosphate Buffered Saline with 10% Glycerol and 0.02% Sodium Azide. |
| Concentration | 1 mg/ml |
| Storage | Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended. |
| Supplier | Antibodies.com |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.
