| Product Name | Anti-APRIL / TNFSF13 Antibody [D05-1D4] |
|---|---|
| Description | Mouse monoclonal [D05-1D4] antibody to APRIL / TNFSF13. |
| Host | Mouse |
| Clonality | Monoclonal |
| Clone | D05-1D4 |
| Conjugate | Unconjugated |
| Immunogen | E. coli derived recombinant protein corresponding to amino acids 105-250 of human CD256. |
| Isotype | IgG2a |
| Target | APRIL / TNFSF13 |
| Amino Acid Sequence | AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL |
| Protein Length | 146 |
| Specificity | This antibody recognises human CD256, also known as APRIL and TNFSF13. CD256, a 17 kDa soluble protein produced from the 32 kDa type II transmembrane protein by cleavage with furin, is a member of the tumor necrosis factor ligand superfamily (TNFLSF).CD256 and its receptor (TNFRSF17/BCMA) are both important for B-cell development. It may also be implicated in the regulation of tumor cell growth and monocyte/macrophage-mediated immunological processes. CD256 is expressed in cancers of the colon, thyroid and lymphoid tissues and on monocytes and macrophages. |
| Reactivity | Human |
| Applications | ELISA, WB |
| Form | Liquid |
| Diluent Buffer | Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide. |
| Concentration | 1 mg/ml |
| Storage | Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended. |
| Supplier | Antibodies.com |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.
