| Product Name | Anti-CD276 Antibody [MJ18] |
|---|---|
| Description | Rat monoclonal [MJ18] antibody to CD276. |
| Host | Rat |
| Clonality | Monoclonal |
| Clone | MJ18 |
| Conjugate | Unconjugated |
| Immunogen | Mouse IgG2a Fc-CD276 amino acids 1-242. |
| Isotype | IgG1 |
| Target | CD276 |
| Amino Acid Sequence | MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPL |
| Protein Length | 242 |
| Specificity | This antibody recognises mouse CD276, otherwise known as B7-H3, a ubiquitously expressed transmembrane glycoprotein and member of the B7 family of co-stimulatory molecules, which acts as both a positive and negative regulator of T-cell-mediated immune responses.CD276 is highly expressed in bone during embryogenesis, and can be induced on dendritic cells and monocytes by inflammatory cytokines. CD276 has been implicated in the development of acute and chronic transplant rejection, and is reported to have therapeutic potential as a regulator of cell-mediated immune responses to cancer, particularly in conjunction with anti-angiogenic therapy. In mice, CD276 has been linked with the development of pathogenic Th2 cells during the induction phase of allergic asthma and have shown that Rat anti Mouse CD276 antibody, clone MJ18 inhibits stimulated CD4+ T-cell proliferation. |
| Reactivity | Mouse |
| Applications | FC |
| Working Dilutions | Flow Cytometry: 1:25 - 1:200, Use 10µl of the suggested working dilution to label 1x106 cells in 100µl. |
| Form | Liquid |
| Diluent Buffer | Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide. |
| Concentration | 1 mg/ml |
| Storage | Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended. |
| Supplier | Antibodies.com |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.