| Product Name | Anti-CD30 Antibody [C03-8D3] |
|---|---|
| Description | Mouse monoclonal [C03-8D3] antibody to CD30. |
| Host | Mouse |
| Clonality | Monoclonal |
| Clone | C03-8D3 |
| Conjugate | Unconjugated |
| Immunogen | E. coli derived recombinant protein corresponding to amino acids 19-595 of human CD30. |
| Isotype | IgG1 |
| Target | CD30 |
| Amino Acid Sequence | FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK |
| Protein Length | 577 |
| Specificity | This antibody recognises the human CD30 cell surface antigen also known as TNFRSF8. CD30 is a 120 kDa, type I transmembrane glycoprotein of the tumour necrosis factor (TNF) receptor superfamily. CD30 was originally identified as a molecule expressed on Hodgkin and Reed Sternberg cells in Hodgkin’s disease but has subsequently been detected on certain non-Hodgkin's malignancies as well as some virally transformed cells. It is also expressed on a subset of activated human T-cells, and by a few extrafollicular T and B-cell blasts in normal lymph nodes. Evidence indicates that CD30 may act as a signal transduction molecule. Binding of CD30 by its ligand induces activation of signalling pathways JNK and NF-?B, expression of lymphocyte genes, proliferation and apoptosis. These and other signalling events of which CD30 is involved contribute to homeostatic regulation of immune responses. |
| Reactivity | Human |
| Applications | ELISA |
| Form | Liquid |
| Diluent Buffer | Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide. |
| Concentration | 1 mg/ml |
| Storage | Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended. |
| Supplier | Antibodies.com |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.
