| Product Name | Anti-IL-21 Antibody |
|---|---|
| Description | Goat polyclonal antibody to IL-21. |
| Host | Goat |
| Clonality | Polyclonal |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptide sequence C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-terminus of human IL-21. |
| Isotype | IgG |
| Target | IL-21 |
| Amino Acid Sequence | C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE |
| Protein Length | 29 |
| Specificity | This antibody recognises human interleukin-21, also known as IL-21 or Za11. IL-21 is a , a 155 amino acid pro-cytokine, reduced to 133 anino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence atthe C-terminus (UniProt: Q9HBE4). recognises an epitope within the N-terminal region of human interleukin-21 (IL-21) and is expected to bind both isoforms.IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway.Goat anti Human Interleukin-21 antibody is suitable for use in immunocytochemistry on human spleen or tonsil cells. |
| Reactivity | Human |
| Applications | ELISA, ICC, IHC-P |
| Working Dilutions | ELISA: 1:50,000 |
| Form | Liquid |
| Diluent Buffer | Supplied in Phosphate Buffered Saline with 0.1% BSA and 0.1% Sodium Azide. |
| Concentration | 1 mg/ml |
| Storage | Store undiluted at -20°C only. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use. |
| Supplier | Antibodies.com |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.
