| Product Name | Apelin 36 (human) |
|---|---|
| Description |
Apelin-36 (human) is an endogenous apelin receptor agonist that is secreted by adipocytes. Apelin-36 (human) binds with high affinity to human apelin receptors expressed in HEK 293 cells (pIC50= 8.61) and is linked to two major types of biological activity: cardiovascular, such as stimulation of cardiac contractility and suppression of blood pressure, and metabolic, including improving glucose homeostasis and lowering body weight, and regulation of cardiovascular function, fluid homeostasis and feeding.
|
| Synonyms | 252642-12-9, Apelin-36 (human), Apelin36 (human), LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Molecular Weight | 4195.87 Da |
| Target | Apelin receptors |
| Amino Acid Sequence | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Form | Freeze dried solid |
| Purity | >95% by hplc |
| Cas Number | 252642-12-9 |
| Storage | Store dry, frozen and in the dark |
| Notes | Modifications: None |
| References |
Tatemoto et al (1998) Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem.Biophys.Res.Comm. 251 471 PMID: 9792798Medhurst et al (2003) Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin. J Neurochem. 84(5) 1162 PMID: 12603839Galon-Tilleman et al (2017) Apelin-36 Modulates Blood Glucose and Body Weight Independently of Canonical APJ Receptor Signaling. J Biol Chem. 292(5):1925 PMID: 27994053 Related areas All peptides >All apelin receptor modulators >All cardiovascular research categories >All appetite regulation research categories > |
| Supplier | Isca Biochemicals Limited |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.
