| Product Name | Bay 55-9837 |
|---|---|
| Description |
Bay 55-9837 is a selective vasoactive intestinal peptide receptor 2 (VPAC2 receptor) agonist, binding to VPAC2 with a Kd of 0.65 nmol/l and having greater than 100-fold selectivity over VPAC1. BAY 55-9837 stimulates glucose-dependent insulin secretion in isolated pancreatic islets, increases insulin synthesis in rat islets, and causes a dose-dependent increase in plasma insulin levels in fasted rats. BAY 55-9837 raises survival motor neuron (SMN) protein levels through pharmacological modulation of the SMN2 gene and ameliorates disease phenotype in severe spinal muscular atrophy mouse models |
| Synonyms | 463930-25-8, Bay 55-9837, HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2, VP-020 |
| Molecular Weight | 3742.29 Da |
| Target | Vasoactive intestinal peptide (VIP) receptors |
| Amino Acid Sequence | HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2 |
| Form | Freeze dried solid |
| Purity | >95% by hplc |
| Cas Number | 463930-25-8 |
| Storage | Store dry, frozen and in the dark |
| Notes | Modifications: C-terminal amide |
| References |
Tsutsumi et al (2002) A potent and highly selective VPAC2 agonist enhances glucose-induced Ins release and glucose disposal: a potential therapy for type 2 diabetes. Diabetes 51 1453 PMID: 11978642Darsalia et al (2013)The specific VPAC2 agonist Bay 55-9837 increases neuronal damage and hemorrhagic transformation after stroke in type 2 diabetic rats. Neuropeptides 47(2) 133 PMID: 22981158Hadwen et al (2014) VPAC2 receptor agonist BAY 55-9837 increases SMN protein levels and moderates disease phenotype in severe spinal muscular atrophy mouse models. Orphanet J Rare Dis. 9 4 PMID: 24405637 Related areasAll peptides >All VIP receptor modulators >All diabetes research categories >All neuroscience research categories >All endocrinology research categories > |
| Supplier | Isca Biochemicals Limited |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.
