Product Name | Cecropin B |
---|---|
Description | Cecropin B is a natural linear cationic α-helical antimicrobial peptide (AMP) originally identified in insects. Cecropin B has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens, killing bacteria by affecting the integrity of the bacterial membranes. Cecropins constitute a main part of the innate immune system of insects. |
Synonyms | 80451-05-4, AMP , Cecropin B, H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2, KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2, antimicrobial |
Molecular Weight | 3834.7 Da |
Target | Antibacterials,Antifungals |
Amino Acid Sequence | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 |
Form | Freeze dried solid |
Purity | >95% by HPLC |
Cas Number | 80451-05-4 |
Storage | Store desiccated, frozen and in the dark |
Notes | Modifications: C terminal amide |
References |
Kulagina et al (2007) Antimicrobial peptides as new recognition molecules for screening challenging species. Sens. Actuators B Chem. 121(1) 150 PMID: 18231571Hu et al (2013) Broad activity against porcine bacterial pathogens displayed by two insect antimicrobial peptides moricin and cecropin B. Mol. Cells 35(2) 106 PMID: 23456332Yu et al (2016) Combination Effects of Antimicrobial Peptides. Antimicrob. Agents and Chemother. 60 (3) 1717 PMID: 26729502 Related areas All antimicrobial peptides >All antifungal agents >All immunology research categories > |
Supplier | Isca Biochemicals Limited |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.