CRF (human, rat)

Category: Bioreagents
Catalog
CR-020
(Ships in 5-10 business days)

Questions? Contact us

Call (800) 832-2611

arp-guarantee
- +
$0.00
More Information
Product Name CRF (human, rat)
Description

CRF (human, rat) is an endogenous peptide derived from a 196-amino acid preprohormone which acts as an agonist for CRF receptors, with Ki values of 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively.  CRF (human, rat) is a major regulator of the hypothalamic pituitary adrenal axis response and is a stress-related neuropeptide whose dysregulation has been associated with depression.  Increased CRF (human, rat) production is also associated with Alzheimer's disease.

Synonyms Corticotropin releasing factor (human, rat), Corticotropin releasing hormone, CRH
Molecular Weight 4757.51 Da
Target Corticotropin releasing factor receptors
Amino Acid Sequence SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Form Freeze dried solid
Purity >95% by hplc
Cas Number 86784-80-7
Storage Store dry, frozen and in the dark
Notes Modifications: C-terminal amide
References Vale et al (1981) Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin. Science. 213(4514) 1394 PMID: 6267699Ohmura and Yoshioka (2008) The roles of corticotropin releasing factor (CRF) in responses to emotional stress: is CRF release a cause or result of fear/anxiety? CNS Neurol Disord Drug Targets. 8(6) 459 PMID: 19811447Jiang et al (2019) Role of Corticotropin Releasing Factor in the Neuroimmune Mechanisms of Depression: Examination of Current Pharmaceutical and Herbal Therapies. Front Cell Neurosci. 13 290 PMID: 31312123
Related areas
All peptides >All corticotropin releasing factor receptor modulators >All endocrinology categories >All neuroscience categories >
Supplier Isca Biochemicals Limited

All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.