| Product Name | GLP-1 (9-36) amide | 
|---|---|
| Description | GLP-1 (9-36) amide, or Glucagon-like peptide-1 (9-36) amide, is a glucoregulatory peptide and the human N-terminally truncated major metabolite of glucagon-like peptide GLP-1 (7-36) amide, formed by dipeptidyl peptidase-IV (DPP IV) cleavage. GLP-1 (9-36) amide acts as an antagonist at the human GLP-1 receptor, inhibits hepatic glucose production and is a weak insulinotropic agent. | 
| Synonyms | Glucagon-like peptide-1 (9-36) amide | 
| Molecular Weight | 3089.4 Da | 
| Target | Glucagon and related receptors | 
| Amino Acid Sequence | EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 
| Form | Freeze dried solid | 
| Purity | >95% by HPLC | 
| Cas Number | 161748-29-4 | 
| Storage | Store dry, frozen and desiccated | 
| Notes | Modifications: C terminal amide | 
| References | 
                    Knudsen and Pridal (1996) Glucagon-like peptide-1-(9-36) amide is a major metabolite of glucagon-like peptide-1-(7-36) amide after in vivo administration to dogs, and it acts as an antagonist on the pancreatic receptor. Eur. J. Pharmacol. 318(2-3) 429 PMID: 9016935Elahi et al (2008) GLP-1 (9-36) amide, cleavage product of GLP-1 (7-36) amide, is a glucoregulatory peptide. Obesity 16(7) 1501 PMID: 18421270Sathananthan et al (2013) Direct Effects of Exendin-(9,39) and GLP-1-(9,36)amide on Insulin Action, β-Cell Function, and Glucose Metabolism in Nondiabetic Subjects. Diabetes 62(8) 2752 PMID: 23545708 Related areasAll peptides >All glucagon and related receptor modulators >All endocrinology research categories >All diabetes research categories >  | 
                
| Supplier | Isca Biochemicals Limited | 
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.