mCRAMP (mouse)

Category: Bioreagents
Catalog
AM-040
(Ships in 5-10 business days)

Questions? Contact us

Call (800) 832-2611

arp-guarantee
- +
$0.00
More Information
Product Name mCRAMP (mouse)
Description mCRAMP (mouse) or mouse calethicidin-related antimicrobial peptide, is the sole murine cathelicidin and intestinal homologue of human LL-37. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon where it exhibits antimicrobial activity against enteric pathogens and it is established as a component of the innate antimicrobial defense in mice. mCRAMP deficiency has been linked to alcoholic liver disease (ALD) in mice and it also produces viral-induced responses in mouse cells. mCRAMP synergises wirh rifamycin for intracellular killing of mycobacteria.
Synonyms Mouse calethicidin related antimicrobial peptide
Molecular Weight 3878.7 Da
Target Antibacterials,Antivirals
Amino Acid Sequence GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Form Freeze dried solid
Purity >95% by HPLC
Storage Store dry, frozen and desiccated
Notes Modifications: None
References Gupta et al (2015) Short, Synthetic Cationic Peptides Have Antibacterial Activity against Mycobacterium smegmatis by Forming Pores in Membrane and Synergizing with Antibiotics. Antibiotics 4(3) 358 PMID: 27025629Yoo et al (2015) Antifibrogenic Effects of the Antimicrobial Peptide Cathelicidin in Murine Colitis-Associated Fibrosis. CMGH Cellular and Molecular Gastroenterology and Hepatology. 1(1) 55 PMID: 25729764Singh et al (2013) The human antimicrobial peptide LL-37, but not the mouse ortholog, mCRAMP, can stimulate signaling by poly(I:C) through a FPRL1-dependent pathway. J. Biol. Chem. 288(12) 8258 PMID: 23386607
Related areas
All antimicrobial peptides >All antiviral agents >All immunology research categories >
Supplier Isca Biochemicals Limited

All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.