| Product Name | PACAP 38 |
|---|---|
| Description |
PACAP 38, or Pituitary adenylate cyclase activating polypeptide-38, is a widely distributed endogenous neuropeptide located in both sensory and parasympathetic perivascular nerve fibes. PACAP 38 acts primarily as a PAC1 agonist and is involved in neuroprotection, neurodevelopment, nociception and inflammation. PACAP 38 is a potent inducer of migraine like attacks in migraineurs and headache in non migraineurs. |
| Synonyms | Pituitary Adenylate Cyclase-Activating Polypeptide 1-38, PACAP 1-38 |
| Molecular Weight | 4534.32 Da |
| Target | PACAP receptors |
| Amino Acid Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH‚‚ |
| Form | Freeze dried solid |
| Purity | 95% by hplc |
| Cas Number | 124123-15-5 |
| Storage | Store dry, frozen and in the dark |
| Notes | Modifications: C terminal amide |
| References |
Lazarovici et al (1998) The 38-amino-acid form of pituitary adenylate cyclase-activating polypeptide induces neurite outgrowth in PC12 cells that is dependent on protein kinase C and extracellular signal-regulated kinase but not on protein kinase A, nerve growth factor receptor Mol.Pharmacol. 54 547 PMID: 9730914Rubio-Beltrán et al (2018) PACAP38 and PAC1 receptor blockade: a new target for headache?. J Headache Pain 19 64 PMID: 30088106Pedersen et al (2019) PACAP-38 and PACAP(6-38) Degranulate Rat Meningeal Mast Cells via the Orphan MrgB3-Receptor. Front. Cellular Neuroscience 13 114 PMID: 30983973Sbei et al (2023) PACAP activates MRGPRX2 on meningeal mast cells to drive migraine-like pain. Sci Rep 13 12302 https://doi.org/10.1038/s41598-023-39571-y Related areas All peptides >All PACAP receptor modulators >All endocrinology research categories >All neuroscience research categories > |
| Supplier | Isca Biochemicals Limited |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.
