| Product Name | Pancreatic polypeptide (human) |
|---|---|
| Description |
Pancreatic polypeptide (human) is an endogenous high affinity agonist for the human NPY Y4 receptor, with a Ki of 0.056 nM. Pancreatic polypeptide (human) is produced and secreted by PP cells of the pancreas which are primarily located in the Islets of Langerhans and is a member of the family of peptides that includes peptide YY (PYY) and neuropeptide Y (NPY). Pancreatic polypeptide (human) is rapidly released after a meal and in humans remains elevated for 4-6 hours, with the vagus nerve being the major stimulator. Pancreatic polypeptide (human) causes a sustained decrease in both appetite and food intake. |
| Synonyms | Pancreatic polypeptide, PP |
| Molecular Weight | 4181.7 Da |
| Target | Neuropeptide Y receptors |
| Amino Acid Sequence | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 |
| Form | Freeze dried solid |
| Purity | >95% |
| Cas Number | 75976-10-2 |
| Storage | Store dry, frozen and in the dark |
| Notes | Modifications: C-terminal amide |
| References |
Bard et al (1995) Cloning and functional expression of a human Y4 subtype receptor for pancreatic polypeptide, neuropeptide Y, and peptide YY. J.Biol.Chem. 270 26762 PMID: 7592911Batterham et al (2003) Pancreatic Polypeptide Reduces Appetite and Food Intake in Humans. J. Clin. Endocrinology Metabolism 88(8) 3989 PMID: 12915697Suzuki et al (2011) The gut hormones in appetite regulation. J Obes. 2011 528401 PMID: 21949903 Related areasAll peptides >All neuropeptide Y receptor modulators >All appetite regulation research categories > |
| Supplier | Isca Biochemicals Limited |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.