| Product Name | Peptide YY (3-36) (human) |
|---|---|
| Description | PYY (3-36) is the N-terminal truncated metabolite of PYY1–36 and is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal. PYY(3-36) reduces appetite and inhibits food intake through action as a Y2 receptor agonist with IC50 values of 0.11 and 1050 nM for inhibition of 125I-PYY binding to Y2 and Y1 receptors respectively. Peptide YY (3-36) can inhibit food intake and reduce weight gain in vivo. |
| Synonyms | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 126339-09-1, GH-120, GH120, PYY (3-36), PYY1 -36, Y2 receptor agonist, appetite , food intake, metabolite, weight gain |
| Molecular Weight | 4049.6 Da |
| Target | Neuropeptide Y receptors |
| Amino Acid Sequence | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Form | Freeze dried solid |
| Purity | >95% by HPLC |
| Cas Number | 126339-09-1 |
| Storage | Store dry, dark and frozen |
| Notes | Modifications: C terminal amide |
| References |
Batterham et al (2002) Gut hormone PYY3-36 physiologically inhibits food intake. Nature 418 650 PMID: 12167864Nonaka et al (2003) Characterization of blood-brain barrier permeability to PYY3-36 in the mouse. J.Pharmacol.Exp.Ther. 306 948 PMID: 12750431Torang et al (2015) The anorexic hormone Peptide YY3-36 is rapidly metabolized to inactive Peptide YY3-34 in vivo. Physiol. Rep. 3(7) e12455 PMID: 26197931 Related areas All peptides >All neuropeptide Y receptor modulators >All appetite regulation research categories > |
| Supplier | Isca Biochemicals Limited |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.
