| Product Name | Peptide YY (human) |
|---|---|
| Description | Peptide YY, also known as PYY and PYY (1-36) is a 36-amino acid peptide that is synthesized and released from enteroendocrine cells. Peptide YY was initially isolated from porcine intestinal extracts and named peptide YY due to the presence of tyrosine residues at the C- and N-termini. Peptide YY belongs to the family of peptides that includes neuropeptide Y (NPY) and pancreatic polypeptide (PP) and all three peptides mediate their effects via G-protein-coupled receptors. Peptide YY binds to all Y-receptor subtypes with similar affinity. Peptide YY in humans has a role in food ingestion, gut motility and insulin secretion, and also suppresses appetite and has been associated with obesity and type 2 diabetes. |
| Synonyms | PYY, PYY (1-36) |
| Molecular Weight | 4049.5 Da |
| Target | Neuropeptide Y receptors |
| Amino Acid Sequence | YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Form | Freeze dried solid |
| Purity | >95% by HPLC |
| Cas Number | 118997-30-1 |
| Storage | Store desiccated, frozen and in the dark |
| Notes | Modifications: C terminal amide |
| References |
Tatemoto and Mutt (1980) Isolation of two novel candidate hormones using a chemical method for finding naturally occurring polypeptides. Nature 285(5764) 417 PMID: 6892950Karra et al (2009) The role of peptide YY in appetite regulation and obesity. J Physiol. 587(1) 19 PMID: 19064614Holzer et al (2012) Neuropeptide Y, peptide YY and pancreatic polypeptide in the gut-brain axis. Neuropeptides 46(6) 261 PMID: 22979996 Related areasAll peptides >All neuropeptide Y receptor modulators >All appetite regulation research categories >All endocrinology research categories >All diabetes research categories > |
| Supplier | Isca Biochemicals Limited |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.