| Product Name | RsAFP2 |
|---|---|
| Description | RsAFP2, or raphanus sativus antifungal peptide 2, is an an antifungal plant defensin isolated from seeds of the radish, raphanus sativus, which interacts with glucosylceramides (GlcCer) in the membranes of susceptible yeast and fungi to induce membrane permeabilization and fungal cell death. RsAFP2 is active against Candida albicans and inhibits to a lesser extent other Candida species, and is nontoxic to mammalian cells. In animal models, RsAFP2 is prophylactically effective against murine candidiasis. |
| Synonyms | Raphanus sativus antifungal peptide 2 |
| Molecular Weight | 5710.6 Da |
| Target | Antifungals |
| Amino Acid Sequence | PyroGlu-KLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC |
| Form | Freeze dried solid |
| Purity | >95% by HPLC |
| Storage | Store dark, frozen and desiccated |
| Notes | Modifications: Disulphide bridges between cysteines 4-51, 15-36, 21-45 and 25-47 |
| References |
Aerts et al (2007) The Antifungal Activity of RsAFP2, a Plant Defensin from Raphanus sativus, Involves the Induction of Reactive Oxygen Species in Candida albicans. J. Mol. Microbiol. Biotechnol. 13 243 PMID: 17827975Bergter et al (2008) In Vitro Activity of the Antifungal Plant Defensin RsAFP2 against Candida Isolates and Its In Vivo Efficacy in Prophylactic Murine Models of Candidiasis. Antimicrob. Agents Chemother. 52(12) 4522 PMID: 18824606Thevissen et al (2012), The plant defensin RsAFP2 induces cell wall stress, septin mislocalization and accumulation of ceramides in Candida albicans. Mol. Microbiol. 84 166 PMID: 22384976 Related areasAll antimicrobial peptides >All antifungal agents >All immunology research areas >All plant science products > |
| Supplier | Isca Biochemicals Limited |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.
