Tat-beclin 1

Category: Bioreagents
Catalog
PP-200
(Ships in 5-10 business days)

Questions? Contact us

Call (800) 832-2611

arp-guarantee
- +
$0.00
More Information
Product Name Tat-beclin 1
Description

Tat-beclin 1 is a cell permeable peptide derived from the domain of the autophagy protein beclin 1 that interacts with HIV-1 Nef, attached to the HIV-1 Tat protein transduction domain.  Tat-beclin 1 activates beclin1 by competing against its negative regulator GAPR-1/glioma pathogenesis-related protein-2 (GLIPR2).  Tat-beclin 1 suppresses the accumulation of htt103Q, a polyglutamine expansion protein derived from human mutant Huntingtin protein, and can inhibit the replication of pathogens including HIV-1 and West Nile virus in vitro and in vivo.  

Synonyms Tat-BECN1, Beclin-1 Activator I, beclin 1 peptide
Molecular Weight 3741.15 Da
Target Protein-protein interactions,Antivirals
Amino Acid Sequence YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
Form Freeze dried solid
Purity >95% by hplc
Cas Number 1423821-88-8
Storage Store dry, frozen and in the dark
Notes Modifications: None
References Shoji-Kawata et al (2013) Identification of a candidate therapeutic autophagy-inducing peptide. Nature 494(7436) 201 PMID: 23364696Maejima (2016) Regulation of autophagy by Beclin 1 in the heart. J Mol Cell Cardiol 95 19 PMID: 26546165Wong (2019) Intestinal epithelial tight junction barrier regulation by autophagy-related protein ATG6/beclin 1. Am J Physiol Cell Physiol. 316(5) C753 PMID: 30892937
Related areas
All cell penetrating peptides >All protein-protein modulators >All antivirals >All regulated cell death categories >
Supplier Isca Biochemicals Limited

All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.