tatM2NX

Category: Bioreagents
Catalog
TP-010
(Ships in 5-10 business days)

Questions? Contact us

Call (800) 832-2611

arp-guarantee
- +
$0.00
More Information
Product Name tatM2NX
Description

tatM2NX is a peptide generated by fusing part of the C-terminus of transient receptor potential melastin 2 (TRPM2) channels, corresponding more than 90% with the Nudix domain (M2NX), with the tat inducer of HIV.  tatM2NX is a TRPM2 antagonist which prevents ligand binding and TRPM2 activation, and inhibits over 90% of human TRPM2 channel currents at concentrations as low as 2 μM.  tatM2NX is an antagonist with an IC50 of 396 nM and is neuroprotective in animal models of focal and global ischemia.

Synonyms TP-010, TP010, YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV, tatM2NX
Molecular Weight 4354.17 Da
Target Transient receptor potential (TRP) channels
Amino Acid Sequence YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV
Form Freeze dried solid
Purity >95% by hplc
Storage Store dry, frozen and in the dark
Notes Modifications: None
References Shimizu et al (2016) Extended therapeutic window of a novel peptide inhibitor of TRPM2 channels following focal cerebral ischemia. Exp Neurol. 283(Pt A) 151 PMID: 27317297Cruz-Torres et al (2020) Characterization and Optimization of the Novel Transient Receptor Potential Melastatin 2 Antagonist tatM2NX. Mol Pharmacol. 97(2) 102 PMID: 31772034
Related data
All cell penetrating peptides >All transient receptor potential channel modulators >All neuroscience categories >
Supplier Isca Biochemicals Limited

All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.