| Product Name | TIP 39 |
|---|---|
| Description |
TIP 39, or Tuberoinfundibular peptide of 39 residues, is a peptide that was first identified from bovine hypothalamus, which in humans is encoded by the PTH2 gene. TIP39 is related to parathyroid hormone and PTH-related protein and is a potent and selective agonist at parathyroid hormone 2 (PTH2) receptors. PTH2 receptors are highly expressed in the nervous system, and have roles in the modulation of pituitary function and in nociception. |
| Synonyms | Tuberoinfundibular neuropeptide, Tuberoinfundibular peptide of 39 residues |
| Molecular Weight | 4504.24 Da |
| Target | Parathyroid hormone receptors |
| Amino Acid Sequence | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
| Form | Freeze dried solid |
| Purity | >95% |
| Storage | Store dry, frozen and in the dark |
| Notes | Modifications: None |
| References |
Usdin et al (1999) TIP39: a new neuropeptide and PTH2-receptor agonist from hypothalamus. Nat. Neurosci 2 941 PMID: 10526330Della Penna et al (2003) Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor, Neuropharmacology 44(1) 141 https://doi.org/10.1016/S0028-3908(02)00335-0Weaver et al (2017) High affinity binding of the peptide agonist TIP-39 to the parathyroid hormone 2 (PTH2) receptor requires the hydroxyl group of Tyr-318 on transmembrane helix 5, Biochemical Pharmacology 127 71 PMID: 28012961 Related areas All peptides >All parathyroid hormone receptor modulators >All endocrinology research categories >All neuroscience research categories > |
| Supplier | Isca Biochemicals Limited |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.