| Product Name | VIP |
|---|---|
| Description |
VIP (Vasoactive intestinal peptide) is a 28 amino acid peptide originally isolated from swine intestines and found to be vasoactive by dilating arterioles. VIP is widely distributed in both the central and peripheral nervous system and is released by both neurons and immune cells. VIP has pleiotropic effects as a neurotransmitter, immune regulator, vasodilator and secretagogue. VIP is a master circadian regulator, as its deletion in mice causes a cycling shift in wake/sleep duration with reduced food intake and body weight. |
| Synonyms | VIP (human, rat, mouse, rabbit, canine, porcine), Vasoactive intestinal peptide, Aviptadil |
| Molecular Weight | 3325.8 Da |
| Target | Vasoactive intestinal peptide (VIP) receptors |
| Amino Acid Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Form | Freeze dried solid |
| Purity | >95% by hplc |
| Cas Number | 40077-57-4 |
| Storage | Store dry, frozen and in the dark |
| Notes | Modifications: C terminal amide |
| References |
Laburthe and Couvineau (2002) Molecular pharmacology and structure of VPAC Receptors for VIP and PACAP. Regul Pept. 08(2-3) 165 PMID: 12220741Delgado and Ganea (2013) Vasoactive intestinal peptide: a neuropeptide with pleiotropic immune functions. Amino Acids. 45(1) 25 PMID: 22139413Bains (2019) Vasoactive Intestinal Peptide Deficiency Is Associated With Altered Gut Microbiota Communities in Male and Female C57BL/6 Mice. Front. Microbiology 10 2689 PMID: 31849864 Related dataAll peptides >All vasoactive intestinal peptide (VIP) receptor modulators >All endocrinology categories >All cardiovascular categories > |
| Supplier | Isca Biochemicals Limited |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.
