| Product Name | WaTx |
|---|---|
| Description | WaTx, also known as wasabi receptor toxin, is the active component of the venom of the Australian black rock scorpion Urodacus manicatus. WaTx targets the mechanical and chemical stress sensor transient receptor potential cation channel 1 (TRPA1), which it stabilizes in an active state characterized by prolonged channel openings and low Ca2+ permeability. WaTx elicits acute pain and pain hypersensitivity, but fails to trigger efferent release of neuropeptides and neurogenic inflammation typically produced by other toxins. WaTx is a unique pharmacological probe for dissecting TRPA1 function and its contribution to acute and persistent pain. |
| Synonyms | Wasabi receptor toxin |
| Molecular Weight | 3855.3 Da |
| Target | Transient receptor potential (TRP) channels |
| Amino Acid Sequence | ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS |
| Form | Freeze dried solid |
| Purity | >95% by HPLC |
| Storage | Storage desiccated, frozen and in the dark |
| Notes | Modifications: Disulphide bridges between cysteine 9 and cysteine 27 and cysteine 13 and cysteine 23 |
| References |
Lin King et al (2019) A Cell-Penetrating Scorpion Toxin Enables Mode-Specific Modulation of TRPA1 and Pain Cell 178(6) 1362 PMID: 31447178 Related areasAll peptides >All transient receptor potential channel modulators >All pain research categories > |
| Supplier | Isca Biochemicals Limited |
All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.
